PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA82G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 415aa    MW: 47328.4 Da    PI: 8.2667
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA82G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.72.4e-141095195
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
          B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                ffk l     ++ + l +p  f+++h +g+++   t +l++  s  +Wevk+  ++++    l +GW++F+ a++L++gD++vF+++g++ f  +v+
  AA82G00001 10 FFKPL--LPGFTDH-LDIPIAFFSKHiKGSNNIVNTAKLKSdASEITWEVKM--NGRR----LCEGWEDFAVAHDLRVGDILVFRHQGEMMF--HVT 95
                56666..5566666.99**********666677789999986888*******..8887....999********************8887666..554 PP

2B366.44e-21137226594
                 -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EE CS
          B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvv 94 
                  +++++l+++   lp++f+  +g +k++ k++tl +e+g++W+++l+y+++sg +++++GW++F++ang k+g +++F l+++ ++++++v
  AA82G00001 137 HVTASNLSRDTRDLPRSFTIPNGVSKNC-KDVTLINEEGKTWNLELKYKNSSGDFYMRRGWRSFCEANGEKAGGSFTFGLVQNgNRGTPLV 226
                 5688999999*********999877766.7***************************************************9989998887 PP

3B3696.4e-22289380497
                 E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
          B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                 +++++ +l++++l+lp +f++++g+++++ k+++l++e+g+sW++ l++ ++ +r ++++GW++F+ +ng k+g+f++Fkl++ +++++v+++f
  AA82G00001 289 AFVTAANLSRDMLYLPTRFTRSNGMNNTRCKEIVLMNENGESWTLILRHHGY-ERLYMRRGWQSFCVSNGKKVGEFCTFKLIK-NGETPVLQLF 380
                 6789999****************9999********************76666.47899************************9.5666888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.4E-205102IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-197106IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.2097100IPR003340B3 DNA binding domain
CDDcd100175.66E-17897No hitNo description
SMARTSM010196.3E-2110100IPR003340B3 DNA binding domain
PfamPF023623.7E-91992IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-16130219IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-17131220IPR015300DNA-binding pseudobarrel domain
CDDcd100176.53E-16133221No hitNo description
PROSITE profilePS5086313.704133233IPR003340B3 DNA binding domain
SMARTSM010193.0E-20134233IPR003340B3 DNA binding domain
PfamPF023626.0E-19137226IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-22281378IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-21283378IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.734286383IPR003340B3 DNA binding domain
CDDcd100174.03E-20286380No hitNo description
SMARTSM010191.4E-31287383IPR003340B3 DNA binding domain
PfamPF023621.2E-20288380IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MADPPLTPHF FKPLLPGFTD HLDIPIAFFS KHIKGSNNIV NTAKLKSDAS EITWEVKMNG  60
RRLCEGWEDF AVAHDLRVGD ILVFRHQGEM MFHVTPFGPS CCQIQYTTSN VKTETLSRNK  120
NSFETKSLLD HSRFVSHVTA SNLSRDTRDL PRSFTIPNGV SKNCKDVTLI NEEGKTWNLE  180
LKYKNSSGDF YMRRGWRSFC EANGEKAGGS FTFGLVQNGN RGTPLVLQLC LSDRVGRGSR  240
KKETEEHQNQ EEEKAEYFST DNDSGSDDEG ELRKNKKVKT ETEDSSFVAF VTAANLSRDM  300
LYLPTRFTRS NGMNNTRCKE IVLMNENGES WTLILRHHGY ERLYMRRGWQ SFCVSNGKKV  360
GEFCTFKLIK NGETPVLQLF HDMSNLGKFC DLEKLGRKKM VKMENQELEG DKSSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405016.11e-120hypothetical protein EUTSA_v10000130mg
TrEMBLV4LRL31e-120V4LRL3_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_40003921e-111(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144901522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-111B3 family protein